PDB entry 5o46

View 5o46 on RCSB PDB site
Description: Crystal structure of Iristatin, a secreted salivary cystatin from the hard tick Ixodes ricinus
Class: hydrolase inhibitor
Keywords: cystatin, protease inhibitor, tick, saliva, hydrolase inhibitor
Deposited on 2017-05-26, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iristatin
    Species: Ixodes ricinus [TaxId:34613]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O46
    Domains in SCOPe 2.07: d5o46a_
  • Chain 'B':
    Compound: Iristatin
    Species: Ixodes ricinus [TaxId:34613]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O46
    Domains in SCOPe 2.07: d5o46b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o46A (A:)
    gmfpgvwrkhhpdvdprykewahfaissqvenrtnfdtlmtlisvesqviagvdyklkmk
    vaestcvigvdsyskercylkvnvpymlctavvnympwehktilksydcsdrvygvksae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o46A (A:)
    fpgvwrkhhpdvdprykewahfaissqvenrtnfdtlmtlisvesqviagvdyklkmkva
    estcvigvdsyskercylkvnvpymlctavvnympwehktilksydcsdrvygv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o46B (B:)
    gmfpgvwrkhhpdvdprykewahfaissqvenrtnfdtlmtlisvesqviagvdyklkmk
    vaestcvigvdsyskercylkvnvpymlctavvnympwehktilksydcsdrvygvksae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o46B (B:)
    fpgvwrkhhpdvdprykewahfaissqvenrtnfdtlmtlisvesqviagvdyklkmkva
    estcvigvdsyskercylkvnvpymlctavvnympwehktilksydcsdrvygv