SCOPe 2.07: Structural Classification of Proteins

PDB entry 5o3z

View 5o3z on RCSB PDB site
Description: Crystal structure of Sorbitol-6-Phosphate 2-dehydrogenase SrlD from Erwinia amylovora
Class: oxidoreductase
Keywords: Sorbitol-6-Phosphate 2-dehydrogenase, fire blight, Rosaceae, Oxidoreductase
Deposited on 2017-05-25, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3za_
Chain 'B':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3zb_
Chain 'C':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3zc_
Chain 'D':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3zd_
Chain 'E':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3ze_
Chain 'F':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (4-262)
Domains in SCOPe 2.07: d5o3zf_
Chain 'G':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3zg_
Chain 'H':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3zh_
Chain 'I':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3zi_
Chain 'J':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (4-262)
Domains in SCOPe 2.07: d5o3zj_
Chain 'K':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3zk_
Chain 'L':
Compound: Sorbitol-6-phosphate dehydrogenase
Species: Erwinia amylovora CFBP1430 [TaxId:665029]
Gene: srlD, EAMY_3073
Database cross-references and differences (RAF-indexed):
- Uniprot D4I194 (Start-262)
Domains in SCOPe 2.07: d5o3zl_
Heterogens: CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5o3zA (A:)
gamameqvavvigggqtlgaflceglaqagyhvavadlnesnanrladtinsrygagray
gfkvdatdeasvealaravdetfgradllvysagvakaapitqfrltdfdlslqvnlvgy
flcsrefsklmirdgikgriiqinsksgkvgskhnsgysaakfggvgltqslaldlaeyg
itvhslmlgnllkspmfqsllpqyaeklgitpeevepyyvdkvplkrgcdyqdvlnvllf
yasdkaayctgqsinvtggqvmf