PDB entry 5o34

View 5o34 on RCSB PDB site
Description: ThnE from S.clavuligerus
Class: lyase
Keywords: Antibiotics, thienamycin biosynthesis, lyase
Deposited on 2017-05-23, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-CoA hydratase carB homologue
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o34a_
  • Chain 'B':
    Compound: Enoyl-CoA hydratase carB homologue
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o34b_
  • Chain 'C':
    Compound: Enoyl-CoA hydratase carB homologue
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o34c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o34A (A:)
    mgaaagerrtlsrkrgttvdvpvkqesrqdrfedqdedrfaaqesiecsrlgdgialaef
    sgaheqnpfsrarmreltalmreldadekvrcvvlyggagrsfgvggdfhevseftggde
    vnawidditdlyttvaaiskpviaaidgyaigvglqislccdyrlgseqarlvmpefrvg
    iacnfggfmleaaagrtvmqrmlltcdewpaeraladgllhetvasprlldralelarti
    sgytaeavqstrprvnapfvaglerirreakeshrrafaageaqvrmrrvigrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o34A (A:)
    iecsrlgdgialaefsgfsrarmreltalmreldadekvrcvvlyggagrsfgdevnawi
    dditdlyttvaaiskpviaaidgyaigvglqislccdyrlgseqarlvmpefrvgiacnf
    ggfmleaaagrtvmqrmlltcdewpaeraladgllhetvasprlldralelartisgyta
    eavqstrprvnapfvaglerirreakesh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o34B (B:)
    mgaaagerrtlsrkrgttvdvpvkqesrqdrfedqdedrfaaqesiecsrlgdgialaef
    sgaheqnpfsrarmreltalmreldadekvrcvvlyggagrsfgvggdfhevseftggde
    vnawidditdlyttvaaiskpviaaidgyaigvglqislccdyrlgseqarlvmpefrvg
    iacnfggfmleaaagrtvmqrmlltcdewpaeraladgllhetvasprlldralelarti
    sgytaeavqstrprvnapfvaglerirreakeshrrafaageaqvrmrrvigrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o34B (B:)
    iecsrlgdgialaefsrarmreltalmreldadekvrcvvlyggagrsfvnawidditdl
    yttvaaiskpviaaidgyaigvglqislccdyrlgseqarlvmpefrvgiacnfggfmle
    aaagrtvmqrmlltcdewpaeraladgllhetvasprlldralelartisgytaeavqst
    rprvnapfvaglerirreakesh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o34C (C:)
    mgaaagerrtlsrkrgttvdvpvkqesrqdrfedqdedrfaaqesiecsrlgdgialaef
    sgaheqnpfsrarmreltalmreldadekvrcvvlyggagrsfgvggdfhevseftggde
    vnawidditdlyttvaaiskpviaaidgyaigvglqislccdyrlgseqarlvmpefrvg
    iacnfggfmleaaagrtvmqrmlltcdewpaeraladgllhetvasprlldralelarti
    sgytaeavqstrprvnapfvaglerirreakeshrrafaageaqvrmrrvigrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o34C (C:)
    iecsrlgdgialaefsrarmreltalmreldadekvrcvvlyggagrsfwidditdlytt
    vaaiskpviaaidgyaigvglqislccdyrlgseqarlvmpefrvgiacnfggfmleaaa
    grtvmqrmlltcdewpaeraladgllhetvasprlldralelartisgytaeavqstrpr
    vnapfvaglerirrea