PDB entry 5o2y

View 5o2y on RCSB PDB site
Description: NMR structure of the calcium bound form of PulG, major pseudopilin from Klebsiella oxytoca T2SS
Class: protein transport
Keywords: Klebsiella oxytoca T2SS, major pseudopilin, calcium, protein transport
Deposited on 2017-05-23, released 2017-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General secretion pathway protein G
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: pulG, AB185_31145, SAMEA2273639_02747
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0G3SCW3 (0-107)
      • expression tag (108-115)
    Domains in SCOPe 2.06: d5o2ya1, d5o2ya2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o2yA (A:)
    mgnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypegg
    yirrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtigfhhhhhhk