PDB entry 5o2y

View 5o2y on RCSB PDB site
Description: NMR structure of the calcium bound form of PulG, major pseudopilin from Klebsiella oxytoca T2SS
Class: protein transport
Keywords: Klebsiella oxytoca T2SS, major pseudopilin, calcium, protein transport
Deposited on 2017-05-23, released 2017-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General secretion pathway protein G
  Species: Klebsiella oxytoca [TaxId:571]
  Gene: pulG, AB185_31145, SAMEA2273639_02747
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0G3SCW3 (0-107)
    • expression tag (108-115)
  Domains in SCOPe 2.08: d5o2ya1, d5o2ya2
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5o2yA (A:)
  mgnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypegg
  yirrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtigfhhhhhhk