PDB entry 5o2u

View 5o2u on RCSB PDB site
Description: Llama VHH in complex with p24
Class: virus
Keywords: VHH Llama antibody HIV capsid protein complex, Virus
Deposited on 2017-05-22, released 2017-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o2ua_
  • Chain 'B':
    Compound: vhh 59h10
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O2U
    Domains in SCOPe 2.07: d5o2ub_
  • Chain 'C':
    Compound: capsid protein p24
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o2uc_
  • Chain 'D':
    Compound: vhh 59h10
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O2U (0-End)
    Domains in SCOPe 2.07: d5o2ud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o2uA (A:)
    mgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqi
    lgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaa
    dtgnnsqvsqnypivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegat
    pqdlntmlntvgghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagtt
    stlqeqigwmthnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrf
    yktlraeqasqevknwmtetllvqnanpdcktilkalgpgatleemmtacqgvggpghka
    rvlaeamsqvtnpatimiqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeg
    hqmkdcterqanflgkiwpshkgrpgnflqsrpeptappeesfrfgeetttpsqkqepid
    kelyplaslrslfgsdpssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o2uA (A:)
    sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
    atleemmtacqgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o2uB (B:)
    dvqlqesggglvqaggslrlscaasgsisrfnamgwwrqapgkerefvarivkgfdpvla
    dsvkgrftisidsaentlalqmnrlkpedtavyycfaaldtaywgqgtqvtvssaaadyk
    pgggkpggepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o2uB (B:)
    vqlqesggglvqaggslrlscaasgsisrfnamgwwrqapgkerefvarivkgfdpvlad
    svkgrftisidsaentlalqmnrlkpedtavyycfaaldtaywgqgtqvtvssaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o2uC (C:)
    mgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqi
    lgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaa
    dtgnnsqvsqnypivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegat
    pqdlntmlntvgghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagtt
    stlqeqigwmthnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrf
    yktlraeqasqevknwmtetllvqnanpdcktilkalgpgatleemmtacqgvggpghka
    rvlaeamsqvtnpatimiqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeg
    hqmkdcterqanflgkiwpshkgrpgnflqsrpeptappeesfrfgeetttpsqkqepid
    kelyplaslrslfgsdpssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o2uC (C:)
    sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
    atleemmtacqgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o2uD (D:)
    dvqlqesggglvqaggslrlscaasgsisrfnamgwwrqapgkerefvarivkgfdpvla
    dsvkgrftisidsaentlalqmnrlkpedtavyycfaaldtaywgqgtqvtvssaaadyk
    pgggkpggepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o2uD (D:)
    dvqlqesggglvqaggslrlscaasgsisrfnamgwwrqapgkerefvarivkgfdpvla
    dsvkgrftisidsaentlalqmnrlkpedtavyycfaaldtaywgqgtqvtvssaa