PDB entry 5o2m

View 5o2m on RCSB PDB site
Description: p130Cas SH3 domain
Class: structure from cyana 3.97
Keywords: SH3 domain, STRUCTURE FROM CYANA 3.97, p130Cas
Deposited on 2017-05-22, released 2017-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Breast cancer anti-estrogen resistance 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCAR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P5Z4 (5-74)
      • expression tag (0-4)
      • conflict (36)
      • expression tag (75-80)
    Domains in SCOPe 2.06: d5o2ma1, d5o2ma2, d5o2ma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o2mA (A:)
    gsmkylnvlakalydnvaespdelsfrkgdimtvlerdtqgldgwwlcslhgrqgivpgn
    rlkilvgmydkkpagefivtd