PDB entry 5o2m

View 5o2m on RCSB PDB site
Description: p130Cas SH3 domain
Class: structure from cyana 3.97
Keywords: SH3 domain, STRUCTURE FROM CYANA 3.97, p130Cas
Deposited on 2017-05-22, released 2017-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Breast cancer anti-estrogen resistance 1
  Species: Homo sapiens [TaxId:9606]
  Gene: BCAR1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6P5Z4 (5-74)
    • expression tag (0-4)
    • conflict (36)
    • expression tag (75-80)
  Domains in SCOPe 2.08: d5o2ma1, d5o2ma2, d5o2ma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5o2mA (A:)
  gsmkylnvlakalydnvaespdelsfrkgdimtvlerdtqgldgwwlcslhgrqgivpgn
  rlkilvgmydkkpagefivtd