PDB entry 5o2i

View 5o2i on RCSB PDB site
Description: An efficient setup for fixed-target, time-resolved serial crystallography with optical excitation
Class: hydrolase
Keywords: time-resolved crystallography, serial synchrotron crystallography (SSX), hydrolase
Deposited on 2017-05-20, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) [TaxId:258594]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o2ia_
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) [TaxId:258594]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o2ib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o2iA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o2iA (A:)
    dladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviv
    adlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlald
    spgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakl
    aswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipv
    pmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o2iB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o2iB (B:)
    ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
    dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
    pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
    swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
    mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsaa