PDB entry 5o27

View 5o27 on RCSB PDB site
Description: crystal structure of murine neuroglobin mutant V140W under 30 bar xenon pressure
Class: transport protein
Keywords: globin, oxygen transporter, transport protein
Deposited on 2017-05-19, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neuroglobin
  Species: Mus musculus [TaxId:10090]
  Gene: NGB
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ER97 (0-147)
    • engineered mutation (52)
    • engineered mutation (117)
    • engineered mutation (137)
  Domains in SCOPe 2.07: d5o27a_
• Heterogens: HEM, SO4, XE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5o27A (A:)
  rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
  dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
  pdftpatrtawsrlygawvqamsrgwdg