PDB entry 5o1s

View 5o1s on RCSB PDB site
Description: Dimethyl fumarate is an allosteric covalent inhibitor of the p90 ribosomal S6 kinases
Class: transferase
Keywords: Covalent, Inhibitor, Kinase, allosteric, transferase
Deposited on 2017-05-19, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein S6 kinase alpha-3
    Species: Mus musculus [TaxId:10090]
    Gene: Rps6ka3, Mapkapk1b, Rps6ka-rs1, Rsk2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18654
      • conflict (214)
    Domains in SCOPe 2.07: d5o1sa_
  • Heterogens: NA, 9HB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o1sA (A:)
    mhhhhhhhhdydipttenlyfqgqtvgvhsivqqlhrnsiqftdgyevkedigvgsysvc
    krcihkatnmefavkiidkskrdpteeieillrygqhpniitlkdvyddgkyvyvvtelm
    kggelldkilrqkffsereasavlftitktveylhaqgvvhrdlkpsnilyvdesgnpes
    iricdfgfakqlraengllmtpcytanfvapevlerqgydaacdiwslgvllytmltgyt
    pfangpddtpeeilarigsgkfslsggywnsvsdtakdlvskmlhvdphqrltaalvlrh
    pwivhwdqlpqyqlnrqdaphlvkgamaatysalnrnqspvlepvgrstlaqrrgikkit
    stal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o1sA (A:)
    siqftdgyevkedisvckrcihkatnmefavkiidkskrdpteeieillrygqhpniitl
    kdvyddgkyvyvvtelmkggelldkilrqkffsereasavlftitktveylhaqgvvhrd
    lkpsnilyvdesgnpesiricdfgfakqlraengllmtpcnfvapevlerqgydaacdiw
    slgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvsdtakdlvskmlhv
    dphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysalnr