PDB entry 5o1r

View 5o1r on RCSB PDB site
Description: human Fab 5H2 bound to NHBA-C3 from Neisseria meningitidis serogroup B
Class: immune system
Keywords: immune system
Deposited on 2017-05-19, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gna2132
    Species: Neisseria meningitidis [TaxId:487]
    Gene: gna2132, nhba
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JPP1 (3-118)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Gna2132
    Species: Neisseria meningitidis [TaxId:487]
    Gene: gna2132, nhba
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JPP1 (3-End)
      • expression tag (1-2)
  • Chain 'H':
    Compound: IGH@ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IGH@
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GMX6 (0-End)
      • conflict (28)
      • insertion (30-31)
      • conflict (32-33)
      • conflict (36)
      • conflict (41-42)
      • conflict (51-54)
      • conflict (59)
      • conflict (70)
      • conflict (74)
      • conflict (84)
      • conflict (95)
      • conflict (99)
      • insertion (102-106)
      • conflict (107-108)
      • conflict (111)
      • conflict (219)
  • Chain 'I':
    Compound: IGH@ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IGH@
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GMX6 (0-End)
      • conflict (28)
      • insertion (30-31)
      • conflict (32-33)
      • conflict (36)
      • conflict (41-42)
      • conflict (51-54)
      • conflict (59)
      • conflict (70)
      • conflict (74)
      • conflict (84)
      • conflict (95)
      • conflict (99)
      • insertion (102-106)
      • conflict (107-108)
      • conflict (111)
      • conflict (219)
  • Chain 'L':
    Compound: Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GMX0 (0-End)
      • conflict (0)
      • conflict (2)
      • conflict (6)
      • conflict (27)
      • conflict (29)
      • conflict (37)
      • conflict (41)
      • conflict (44)
      • conflict (47)
      • conflict (54)
      • conflict (70)
      • conflict (80)
      • conflict (92-93)
      • conflict (98)
      • conflict (101-102)
      • conflict (105)
    Domains in SCOPe 2.07: d5o1rl1, d5o1rl2
  • Chain 'M':
    Compound: Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GMX0 (0-End)
      • conflict (0)
      • conflict (2)
      • conflict (6)
      • conflict (27)
      • conflict (29)
      • conflict (37)
      • conflict (41)
      • conflict (44)
      • conflict (47)
      • conflict (54)
      • conflict (70)
      • conflict (80)
      • conflict (92-93)
      • conflict (98)
      • conflict (101-102)
      • conflict (105)
    Domains in SCOPe 2.07: d5o1rm1, d5o1rm2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5o1rL (L:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o1rL (L:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5o1rM (M:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o1rM (M:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge