PDB entry 5o17

View 5o17 on RCSB PDB site
Description: Crystal structure of murine neuroglobin under 100 bar krypton
Class: oxygen storage
Keywords: Globin, oxygen storage-transporter, transport protein, OXYGEN STORAGE
Deposited on 2017-05-18, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97 (0-147)
      • engineered mutation (52)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d5o17a_
  • Heterogens: HEM, SO4, KR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5o17A (A:)
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg