PDB entry 5o0y

View 5o0y on RCSB PDB site
Description: TLK2 kinase domain from human
Class: transferase
Keywords: Kinase, ATPgS, chromatin remodelling, DNA replication, transferase
Deposited on 2017-05-17, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase tousled-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TLK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0ya_
  • Heterogens: AGS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o0yA (A:)
    mgsshhhhhhstgstehscssqkqisiqhrqtqsdltiekisalensknsdlekkegrid
    dllrancdlrrqideqqkmlekykerlnrcvtmskklliekskqekmacrdksmqdrlrl
    ghfttvrhgasfteqwtdgyafqnlikqqerinsqreeierqrkmlakrkppamgqappa
    tneqkqrksktngaenetpssgntelkdtapalgahsllrltlaeyheqeeifklrlghl
    kkeeaeiqaelerlervrnlhirelkrihnednsqfkdhptlndrylllhllgrggfsev
    ykafdlteqryvavkihqlnknwrdekkenyhkhacreyrihkeldhprivklydyfsld
    tdsfctvleycegndldfylkqhklmsekearsiimqivnalkylneikppiihydlkpg
    nillvngtacgeikitdfglskimdddsynsvdgmeltsqgagtywylppecfvvgkepp
    kisnkvdvwsvgvifyqclygrkpfghnqsqqdilqentilkatevqfppkpvvtpeaka
    firrclayrkedridvqqlacdpyllphirksvstsspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0yA (A:)
    ptlndrylllhllgrggfsevykafdlteqryvavkihqlnknwrdekkenyhkhacrey
    rihkeldhprivklydyfsldtdsfctvleycegndldfylkqhklmsekearsiimqiv
    nalkylneikppiihydlkpgnillvngtacgeikitdfglskimdddsynsvdgmelts
    qgagtywylppecfvvgkeppkisnkvdvwsvgvifyqclygrkpfghnqsqqdilqent
    ilkatevqfppkpvvtpeakafirrclayrkedridvqqlacdpyllp