PDB entry 5o0w

View 5o0w on RCSB PDB site
Description: Crystal structure of the complex between Nb474 and Trypanosoma congolense fructose-1,6-bisphosphate aldolase
Class: lyase
Keywords: complex, Nanobody, aldolase, diagnosis, lyase
Deposited on 2017-05-17, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase
    Species: Trypanosoma congolense (strain IL3000) [TaxId:1068625]
    Gene: TCIL3000_10_4760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0wa_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase
    Species: Trypanosoma congolense (strain IL3000) [TaxId:1068625]
    Gene: TCIL3000_10_4760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0wb_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase
    Species: Trypanosoma congolense (strain IL3000) [TaxId:1068625]
    Gene: TCIL3000_10_4760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0wc_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase
    Species: Trypanosoma congolense (strain IL3000) [TaxId:1068625]
    Gene: TCIL3000_10_4760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0wd_
  • Chain 'E':
    Compound: Nb474
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O0W
    Domains in SCOPe 2.07: d5o0we1, d5o0we2
  • Chain 'F':
    Compound: Nb474
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O0W
    Domains in SCOPe 2.07: d5o0wf1, d5o0wf2
  • Chain 'G':
    Compound: Nb474
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O0W
    Domains in SCOPe 2.07: d5o0wg1, d5o0wg2
  • Chain 'H':
    Compound: Nb474
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O0W
    Domains in SCOPe 2.07: d5o0wh1, d5o0wh2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o0wA (A:)
    msrrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagigls
    ntaehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdc
    gleplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaet
    laryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllk
    pnmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnns
    plprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddk
    dsqslyvagntyenlyfqsgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0wA (A:)
    srrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagiglsn
    taehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdcg
    leplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaetl
    aryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllkp
    nmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnnsp
    lprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o0wB (B:)
    msrrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagigls
    ntaehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdc
    gleplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaet
    laryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllk
    pnmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnns
    plprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddk
    dsqslyvagntyenlyfqsgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0wB (B:)
    srrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagiglsn
    taehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdcg
    leplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaetl
    aryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllkp
    nmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnnsp
    lprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgddd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o0wC (C:)
    msrrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagigls
    ntaehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdc
    gleplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaet
    laryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllk
    pnmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnns
    plprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddk
    dsqslyvagntyenlyfqsgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0wC (C:)
    srrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagiglsn
    taehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdcg
    leplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaetl
    aryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllkp
    nmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnnsp
    lprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o0wD (D:)
    msrrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagigls
    ntaehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdc
    gleplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaet
    laryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllk
    pnmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnns
    plprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddk
    dsqslyvagntyenlyfqsgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0wD (D:)
    srrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagiglsn
    taehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdcg
    leplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaetl
    aryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllkp
    nmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnnsp
    lprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5o0wE (E:)
    qvqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsga
    rtdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctis
    sdtydywgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0wE (E:)
    vqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsgar
    tdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctiss
    dtydywgqgtqvtvssh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5o0wF (F:)
    qvqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsga
    rtdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctis
    sdtydywgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0wF (F:)
    vqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsgar
    tdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctiss
    dtydywgqgtqvtvssh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5o0wG (G:)
    qvqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsga
    rtdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctis
    sdtydywgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0wG (G:)
    vqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsgar
    tdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctiss
    dtydywgqgtqvtvsshh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5o0wH (H:)
    qvqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsga
    rtdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctis
    sdtydywgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0wH (H:)
    vqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsgar
    tdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctiss
    dtydywgqgtqvtvss