PDB entry 5o0i

View 5o0i on RCSB PDB site
Description: ADP-dependent glucokinase from Pyrococcus horikoshii
Class: transferase
Keywords: ADP-dependent glucokinase, TRANSFERASE
Deposited on 2017-05-16, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-dependent glucokinase
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: glkA, PH0589
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0ia_
  • Heterogens: SO4, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o0iA (A:)
    mtnweslyekaldkveasirkvrgvllayntnidaikylkredlekriekvgkeevlrys
    eelpkeietipqllgsilwsikrgkaaellvvsrevreymrkwgwdelrmggqvgimanl
    lggvygipviahvpqlselqaslfldgpiyvptfergelrlihprefrkgeedcihyiye
    fprnfkvldfeaprenrfigaaddynpilyvreewierfeeiakrselaiisglhpltqe
    nhgkpiklvrehlkilndlgirahlefaftpdevvrleivkllkhfysvglnevelasvv
    svmgekelaeriiskdpadpiaviegllkliketgvkrihfhtygyylaltrekgehvrd
    allfsalaaatkamkgnieklsdireglavpigeqglevekilekefslrdgigsiedyq
    ltfiptkvvkkpkstvgigdtisssafvsefslh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0iA (A:)
    mtnweslyekaldkveasirkvrgvllayntnidaikylkredlekriekvgkeevlrys
    eelpkeietipqllgsilwsikrgkaaellvvsrevreymrkwgwdelrmggqvgimanl
    lggvygipviahvpqlselqaslfldgpiyvptfergelrlihprefrkgeedcihyiye
    fprnfkvldfeaprenrfigaaddynpilyvreewierfeeiakrselaiisglhpltqe
    nhgkpiklvrehlkilndlgirahlefaftpdevvrleivkllkhfysvglnevelasvv
    svmgekelaeriiskdpadpiaviegllkliketgvkrihfhtygyylaltrekgehvrd
    allfsalaaatkamkgnieklsdireglavpigeqglevekilekefslrdgigsiedyq
    ltfiptkvvkkvgigdtisssafvsefslh