PDB entry 5o0h

View 5o0h on RCSB PDB site
Description: Crystal structure of Phosphopantetheine adenylyltransferase from Mycobacterium abcessus in complex with 2-(4-Chloro-3-nitrobenzoyl)benzoic acid (Fragment 6)
Class: transferase
Keywords: Coenzyme A Biosynthesis, Transferase
Deposited on 2017-05-16, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) [TaxId:561007]
    Gene: coaD, MAB_3259c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0ha_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) [TaxId:561007]
    Gene: coaD, MAB_3259c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o0hb_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) [TaxId:561007]
    Gene: coaD, MAB_3259c
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1MDL6 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d5o0hc1, d5o0hc2
  • Heterogens: 9FN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o0hA (A:)
    smtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemiresta
    dlpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvata
    paysfvssslakevatyggdvsallpasvhqrllgklrgqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0hA (A:)
    mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad
    lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    aysfvssslakevatyggdvsallpasvhqrllgklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o0hB (B:)
    smtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemiresta
    dlpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvata
    paysfvssslakevatyggdvsallpasvhqrllgklrgqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0hB (B:)
    mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad
    lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    aysfvssslakevatyggdvsallpasvhqrllgklr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o0hC (C:)
    smtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemiresta
    dlpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvata
    paysfvssslakevatyggdvsallpasvhqrllgklrgqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o0hC (C:)
    smtgavcpgsfdpvtlghldvferaaaqfdevivavlinpagmftvderiemirestadl
    pnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatapa
    ysfvssslakevatyggdvsallpasvhqrllgklr