PDB entry 5o05

View 5o05 on RCSB PDB site
Description: GII.10 Vietnam 026 norovirus protruding domain in complex with Nanobody Nano-42
Class: viral protein
Keywords: Norovirus, Protruding domain, capsid protein, Nanobody, VHH, viral protein
Deposited on 2017-05-16, released 2017-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Norwalk virus [TaxId:11983]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: capsid protein
    Species: Norwalk virus [TaxId:11983]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nanobody (VHH) Nano-42
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O05 (0-End)
    Domains in SCOPe 2.06: d5o05c_
  • Chain 'D':
    Compound: Nanobody (VHH) Nano-42
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O05 (0-End)
    Domains in SCOPe 2.06: d5o05d_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >5o05C (C:)
qvqlqesggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnya
dslkgrftisrenaentvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtvss

    Sequence, based on observed residues (ATOM records): (download) 
    >5o05C (C:)
qvqlqesggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnya
dslkgrftisraentvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtv

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >5o05D (D:)
qvqlqesggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnya
dslkgrftisrenaentvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtvss

    Sequence, based on observed residues (ATOM records): (download) 
    >5o05D (D:)
qvqlqesggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnya
dslkgrftisrntvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtv