PDB entry 5nzf

View 5nzf on RCSB PDB site
Description: Complex of H275Y/I223V mutant variant of neuraminidase from H1N1 influenza virus with oseltamivir
Class: viral protein
Keywords: neuraminidase, influenza, complex, inhibitor, Viral protein
Deposited on 2017-05-14, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot W5R8B8 (0-End)
      • conflict (141)
      • conflict (193)
    Domains in SCOPe 2.07: d5nzfa_
  • Chain 'B':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot W5R8B8 (0-End)
      • conflict (141)
      • conflict (193)
    Domains in SCOPe 2.07: d5nzfb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot W5R8B8 (0-End)
      • conflict (141)
      • conflict (193)
    Domains in SCOPe 2.07: d5nzfc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot W5R8B8 (0-End)
      • conflict (141)
      • conflict (193)
    Domains in SCOPe 2.07: d5nzfd_
  • Heterogens: CA, G39, NAG, EDO, BMA, MAN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nzfA (A:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnvlrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nzfA (A:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnvlrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nzfB (B:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnvlrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nzfB (B:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnvlrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nzfC (C:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnvlrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nzfC (C:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnvlrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nzfD (D:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnvlrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nzfD (D:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnvlrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftid