PDB entry 5nze

View 5nze on RCSB PDB site
Description: Complex of S247N mutant variant of neuraminidase from H1N1 influenza virus with oseltamivir
Class: viral protein
Keywords: neuraminidase, influenza, complex, inhibitor, Viral protein
Deposited on 2017-05-13, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot W5R8B8 (0-End)
      • conflict (165)
    Domains in SCOPe 2.07: d5nzea_
  • Chain 'B':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot W5R8B8 (0-End)
      • conflict (165)
    Domains in SCOPe 2.07: d5nzeb_
  • Heterogens: CA, G39, NAG, EDO, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nzeA (A:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpnngqasykifriekg
    kivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nzeA (A:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpnngqasykifriekg
    kivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nzeB (B:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpnngqasykifriekg
    kivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nzeB (B:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpnngqasykifriekg
    kivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftid