PDB entry 5nz0

View 5nz0 on RCSB PDB site
Description: Structure of Transcriptional Regulatory Repressor Protein - EthR from Mycobacterium Tuberculosis in complex with linezolid
Class: transcription
Keywords: EthR, transcription, represor, boosting effect
Deposited on 2017-05-12, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator EthR
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: ethR, etaR, Rv3855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nz0a1, d5nz0a2
  • Heterogens: ZLD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nz0A (A:)
    mdiefttsaasqaslprgrrtarpsgddrelailataenlledrpladisvddlakgagi
    srptfyfyfpskeavlltlldrvvnqadmalqtlaenpadtdrenmwrtginvffetfgs
    hkavtragqaaratsvevaelwstfmqkwiaytaavidaerdrgaaprtlpahelataln
    lmnertlfasfageqpsvpearvldtlvhiwvtsiygenrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nz0A (A:)
    gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
    qadmalqtlaenpdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqk
    wiaytaavidaerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlv
    hiwvtsiyge