PDB entry 5nyx

View 5nyx on RCSB PDB site
Description: human Fab fragment 5H2 against NHBA from Neisseria meningitidis
Class: immune system
Keywords: immune system
Deposited on 2017-05-12, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NYX (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NYX (0-End)
    Domains in SCOPe 2.07: d5nyxl1, d5nyxl2
  • Chain 'M':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NYX
  • Chain 'N':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NYX (0-End)
    Domains in SCOPe 2.07: d5nyxn1, d5nyxn2
  • Chain 'O':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NYX (0-End)
  • Chain 'P':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NYX (0-End)
    Domains in SCOPe 2.07: d5nyxp1, d5nyxp2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5nyxL (L:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nyxL (L:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5nyxN (N:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nyxN (N:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5nyxP (P:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
    rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nyxP (P:)
    eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltrfsgsgsgtdlt
    ltisslrpedfatyycqqsygsptfgqgtkleirrtvaapsvfifppsdeqlksgtasvv
    cllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvya
    cevthqglsspvtksfnrg