PDB entry 5nyv

View 5nyv on RCSB PDB site
Description: Crystal structure determination from picosecond infrared laser ablated protein crystals by serial synchrotron crystallography
Class: hydrolase
Keywords: SSX; PIRL; serial crystallography, fixed target, hydrolase
Deposited on 2017-05-11, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris ATCC 17001 [TaxId:74570]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nyva_
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris ATCC 17001 [TaxId:74570]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nyvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nyvA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nyvA (A:)
    ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
    dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
    pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
    swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
    mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nyvB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nyvB (B:)
    pdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkvi
    vadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlal
    dspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkak
    laswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkip
    vpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs