PDB entry 5nyn

View 5nyn on RCSB PDB site
Description: Crystal structure of the atypical poplar thioredoxin-like2.1 in complex with gluathione
Class: oxidoreductase
Keywords: atypical thioredoxin, disulfide exchange, oxidoreductase
Deposited on 2017-05-11, released 2018-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-like protein 2.1
    Species: Populus tremula x Populus tremuloides [TaxId:47664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nyna_
  • Heterogens: GSH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5nynA (A:)
matrptsvemepiddshhldkillqarelsqpiiidwmaswcrkciylkpkleklaaeyd
tkikfycadvnkvpqalvkrgniskmptiqlwkdgemkaevigghkawlvieevremiqk
fv

    Sequence, based on observed residues (ATOM records): (download) 
    >5nynA (A:)
rptsvemepiddshhldkillqarelsqpiiidwmaswcrkciylkpkleklaaeydtki
kfycadvnkvpqalvkrgniskmptiqlwkdgemkaevigghkawlvieevremiqkfv