PDB entry 5nyi

View 5nyi on RCSB PDB site
Description: Crystal Structure of Hsp90-alpha N-Domain in complex with Resorcinol derivative
Class: chaperone
Keywords: chaperone
Deposited on 2017-05-11, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900
      • conflict (23)
      • conflict (31)
      • conflict (42)
      • conflict (44-45)
      • conflict (55)
      • conflict (60)
      • conflict (64)
      • conflict (105)
      • conflict (121)
      • conflict (132)
      • conflict (156-157)
      • conflict (161)
      • conflict (203)
      • conflict (216)
    Domains in SCOPe 2.08: d5nyia_
  • Heterogens: 2EQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nyiA (A:)
    gdqpmeeeevetfafqaeiaqlmtliintfytnkeiflrelitnttdaldkiryetltdp
    tkldtgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaktgtkafmealqagad
    itmigqfgvgfytaylvaekvtvitkhnddeqyawettaggtftvrtdtgepmgrgtkvi
    lhlkedqteyleerrikeivkkhtqfigypitlfveeerdkevtddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nyiA (A:)
    evetfafqaeiaqlmtliintfytnkeiflrelitnttdaldkiryetltdptkldtgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaktgtkafmealqagaditmigqfg
    vgfytaylvaekvtvitkhnddeqyawettaggtftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhtqfigypitlfvee