PDB entry 5nxy

View 5nxy on RCSB PDB site
Description: Crystal structure of OpuAC from B. subtilis in complex with Arsenobetaine
Class: choline-binding protein
Keywords: substrate binding protein Arseen, B. subtilis, CHOLINE-BINDING PROTEIN
Deposited on 2017-05-11, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Osmotically activated L-carnitine/choline ABC transporter substrate-binding protein OpuCC
    Species: Bacillus subtilis [TaxId:1423]
    Gene: B4417_3194
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nxya_
  • Chain 'C':
    Compound: Osmotically activated L-carnitine/choline ABC transporter substrate-binding protein OpuCC
    Species: Bacillus subtilis [TaxId:1423]
    Gene: B4417_3194
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nxyc_
  • Heterogens: 1Y8, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nxyA (A:)
    cslpglsaaadqtikigaqsmseseiiasmqgqliehhtdlktttiknlgsnavqqqalm
    ngeidiaatrytgdaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaft
    vskeladqyhletvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqig
    lvydavksgkmdivlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpeleg
    iikkmlgkidtatmqelnyevdgnlkepsvvakeylekhryfes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxyA (A:)
    qtikigaqsmseseiiasmqgqliehhtdlktttiknlgsnavqqqalmngeidiaatry
    tgdaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvskeladqyhl
    etvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvydavksgkm
    divlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgkidt
    atmqelnyevdgnlkepsvvakeylekhryfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nxyC (C:)
    cslpglsaaadqtikigaqsmseseiiasmqgqliehhtdlktttiknlgsnavqqqalm
    ngeidiaatrytgdaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaft
    vskeladqyhletvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqig
    lvydavksgkmdivlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpeleg
    iikkmlgkidtatmqelnyevdgnlkepsvvakeylekhryfes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxyC (C:)
    qtikigaqsmseseiiasmqgqliehhtdlktttiknlgqqalmngeidiaatrytgdal
    tgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvskeladqyhletvsd
    vkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvydavksgkmdivla
    ystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgkidtatmqe
    lnyevdgnlkepsvvakeylekhryfe