PDB entry 5nxl

View 5nxl on RCSB PDB site
Description: Formylglycine generating enzyme from T. curvata in complex with Ag(I)
Class: transferase
Keywords: formylglycine generating enzyme, sulfatase modification, metal-binding, silver complex, copper enzyme, TRANSFERASE
Deposited on 2017-05-10, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-specific serine/threonine protein kinase
    Species: Thermomonospora curvata DSM 43183 [TaxId:471852]
    Gene: Tcur_4811
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1A7C3 (16-End)
      • expression tag (7-15)
    Domains in SCOPe 2.07: d5nxla1, d5nxla2
  • Heterogens: AG, MPD, ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nxlA (A:)
    ghhhhhhaenlyfqghmvaipggtfrmggedpdafpedgegpvrtvrlspflidryavsn
    rqfaafvkatgyvtdaerygwsfvfhahvapgtpvmdavvpeapwwvavpgaywkapegp
    gssitdrpnhpvvhvswndavayatwagkrlpteaewemaarggldqarypwgneltprg
    rhrcniwqgtfpvhdtgedgytgtapvnafapngyglynvagnvwewcadwwsadwhate
    spatridprgpetgtarvtkggsflchesycnryrvaartcntpdssaahtgfrcaadpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxlA (A:)
    aenlyfqghmvaipggtfrmggedpdafpedgegpvrtvrlspflidryavsnrqfaafv
    katgyvtdaerygwsfvfhahvdavvpeapwwvavpgaywkapegpgssitdrpnhpvvh
    vswndavayatwagkrlpteaewemaarggldqarypwgneltprgrhrcniwqgtfpvh
    dtgedgytgtapvnafapngyglynvagnvwewcadwwsadwhatespatridprgpetg
    tarvtkggsflchesycnryrvaartcntpdssaahtgfrcaadp