PDB entry 5nxa

View 5nxa on RCSB PDB site
Description: Crystal structure of Neanderthal Adenylosuccinate Lyase (ADSL)in complex with its products AICAR and fumarate
Class: lyase
Keywords: Adenylosuccinate Lyase, fumarase, lyase
Deposited on 2017-05-09, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Gene: ADSL, AMPS
    Database cross-references and differences (RAF-indexed):
    • PDB 5NXA (Start-486)
    Domains in SCOPe 2.07: d5nxaa_
  • Chain 'B':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Gene: ADSL, AMPS
    Database cross-references and differences (RAF-indexed):
    • PDB 5NXA (Start-486)
    Domains in SCOPe 2.07: d5nxab_
  • Chain 'C':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Gene: ADSL, AMPS
    Database cross-references and differences (RAF-indexed):
    • PDB 5NXA
    Domains in SCOPe 2.07: d5nxac_
  • Chain 'D':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Gene: ADSL, AMPS
    Database cross-references and differences (RAF-indexed):
    • PDB 5NXA (Start-486)
    Domains in SCOPe 2.07: d5nxad_
  • Chain 'E':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Gene: ADSL, AMPS
    Database cross-references and differences (RAF-indexed):
    • PDB 5NXA (Start-486)
    Domains in SCOPe 2.07: d5nxae_
  • Chain 'F':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Gene: ADSL, AMPS
    Database cross-references and differences (RAF-indexed):
    • PDB 5NXA (Start-486)
    Domains in SCOPe 2.07: d5nxaf_
  • Chain 'G':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Gene: ADSL, AMPS
    Database cross-references and differences (RAF-indexed):
    • PDB 5NXA (Start-486)
    Domains in SCOPe 2.07: d5nxag_
  • Chain 'H':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Gene: ADSL, AMPS
    Database cross-references and differences (RAF-indexed):
    • PDB 5NXA (Start-486)
    Domains in SCOPe 2.07: d5nxah_
  • Heterogens: SSS, CL, FUM, AMZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nxaA (A:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxaA (A:)
    gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemks
    nlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrna
    ldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlk
    rvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkv
    dievlsvlaslgasvhkictdirllanlkemeepkrnpmrserccslarhlmtlvmdplq
    tasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrirqelpfm
    ateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqadayfspihsql
    dhlldpssftgrasqqvqrfleeevypllkpyesvmkvkaelcl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nxaB (B:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxaB (B:)
    gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlgatscyvgdntdliilrnald
    lllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlkrv
    rddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkvdi
    evlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrserccslar
    hlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvi
    errirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqa
    dayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmkvkaelcl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nxaC (C:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxaC (C:)
    spdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemksn
    lenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrnal
    dlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlkr
    vrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkvd
    ievlsvlaslgasvhkictdirllanlkemeepfekrnpmrserccslarhlmtlvmdpl
    qtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrirqelpf
    mateniimamvkhsqldhlldpssftgrasqqvqrfleeevypllkpyesvmkvkael
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nxaD (D:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxaD (D:)
    gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemks
    nlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrna
    ldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlk
    rvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkv
    dievlsvlaslgasvhkictdirllanlkemeepfekqqkrnpmrserccslarhlmtlv
    mdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrirq
    elpfmateniidchekirvlsqqaasvvkqeggdndlierdpssftgrasqqvqrfleee
    vypllkpyesvmkvkaelcl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5nxaE (E:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxaE (E:)
    gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemks
    nlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrna
    ldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlk
    rvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkv
    dievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrserccsl
    arhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypk
    vierrirqelpfmateniimchekirvlsqqaasvvkqeggdndlieriqadayfspihs
    qldhlldpssftgrasqqvqrfleeevypllkpyesvmkvkaelcl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nxaF (F:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxaF (F:)
    gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemks
    nlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrna
    ldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlk
    rvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkv
    dievlsvlaslgasvhkictdirllanlkemeepfekrnpmrserccslarhlmtlvmdp
    lqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrirqelp
    fmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqadayfspihs
    qldhlldpssftgrasqqvqrfleeevypllkpyesvmkvkaelcl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5nxaG (G:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxaG (G:)
    spdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemksn
    lenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrnal
    dlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlkr
    vrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkvd
    ievlsvlaslgasvhkictdirllanlkemeepkrnpmrserccslarhlmtlvmdplqt
    asvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrirqelpfma
    teniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqadayfspihsqld
    hlldpssftgrasqqvqrfleeevypllkpyesvmkvkaelcl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5nxaH (H:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nxaH (H:)
    gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemks
    nlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrna
    ldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlk
    rvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkv
    dievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrserccsl
    arhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypk
    vierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieri
    qadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmkvkaelcl