PDB entry 5nx8

View 5nx8 on RCSB PDB site
Description: Crystal structure of Neanderthal Adenylosuccinate Lyase (ADSL)
Class: lyase
Keywords: Adenylosuccinate Lyase, fumarase, lyase
Deposited on 2017-05-09, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NX8
    Domains in SCOPe 2.07: d5nx8a_
  • Chain 'B':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NX8
    Domains in SCOPe 2.07: d5nx8b_
  • Chain 'C':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NX8
    Domains in SCOPe 2.07: d5nx8c_
  • Chain 'D':
    Compound: adenylosuccinate lyase
    Species: Homo sapiens neanderthalensis [TaxId:63221]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NX8
    Domains in SCOPe 2.07: d5nx8d_
  • Heterogens: PEG, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nx8A (A:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx8A (A:)
    spdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemksn
    lenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrnal
    dlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlkr
    vrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkvd
    ievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrserccsla
    rhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkv
    ierrirqelpfmateniimqaasvvkqeggdndlieriqadayfspihsqldhlldpssf
    tgrasqqvqrfleeevypllkpyesvmkvkae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nx8B (B:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx8B (B:)
    gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemks
    nlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrna
    ldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlk
    rvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkv
    dievlsvlaslgasvhkictdirllanlkemeepfekmpykrnpmrserccslarhlmtl
    vmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrir
    qelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqadayfs
    pihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmkvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nx8C (C:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx8C (C:)
    spdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemksn
    lenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrnal
    dlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlkr
    vrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkvd
    ievlsvlaslgasvhkictdirllanlkemeeprnpmrserccslarhlmtlvmdplqta
    svqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrirqelpfmat
    eniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqadayfspihsqldh
    lldpssftgrasqqvqrfleeevypllkpye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nx8D (D:)
    gshmaaggdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpi
    tdeqiqemksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgd
    ntdliilrnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiq
    dlcmdlqnlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafi
    itgqtytrkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrn
    pmrserccslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqn
    iseglvvypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqe
    ggdndlieriqadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmk
    vkaelcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx8D (D:)
    gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemks
    nlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrna
    ldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlk
    rvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkv
    dievlsvlaslgasvhkictdirllanlkemeepfekqqigpykrnpmrserccslarhl
    mtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvier
    rirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqada
    yfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesv