PDB entry 5nx1

View 5nx1 on RCSB PDB site
Description: Combinatorial Engineering of Proteolytically Resistant APPI Variants that Selectively Inhibit Human Kallikrein 6 for Cancer Therapy
Class: hydrolase
Keywords: Serine_protease, inhibitor, complex, hydrolase
Deposited on 2017-05-09, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-6
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK6, PRSS18, PRSS9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92876 (0-End)
      • conflict (56)
      • conflict (58)
      • conflict (112)
    Domains in SCOPe 2.07: d5nx1a_
  • Chain 'B':
    Compound: Amyloid-beta A4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Amyloid-beta A4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nx1c_
  • Chain 'D':
    Compound: Amyloid-beta A4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nx1A (A:)
    lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
    ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
    gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
    vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx1A (A:)
    lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
    ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
    gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
    vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqa
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nx1C (C:)
    yvdykddddkefevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteey
    cmavcgsaiprhhhhhhaaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx1C (C:)
    evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg
    

  • Chain 'D':
    No sequence available.