PDB entry 5nwx
View 5nwx on RCSB PDB site
Description: Insight into the molecular recognition mechanism of the coactivator NCoA1 by STAT6
Class: transcription
Keywords: NcoA1, STAT6, PAS-B domain, transactivation domain, transcription
Deposited on
2017-05-08, released
2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated
2017-12-13, with a file datestamp of
2017-12-08.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.19
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Nuclear receptor coactivator 1
Species: Mus musculus [TaxId:10090]
Gene: NCOA1, SRC1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5nwxa_ - Chain 'B':
Compound: signal transducer and activator of transcription 6
Species: Homo sapiens [TaxId:9606]
Gene: STAT6
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5nwxA (A:)
ghmtgvesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarql
fqevmtrgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidrehsglsp
qddtnsgmsipr
Sequence, based on observed residues (ATOM records): (download)
>5nwxA (A:)
vesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqevm
trgtasspsyrfilndgtmlsahtrcklcypqpfimgihiidr
- Chain 'B':
No sequence available.