PDB entry 5nwx

View 5nwx on RCSB PDB site
Description: Insight into the molecular recognition mechanism of the coactivator NCoA1 by STAT6
Class: transcription
Keywords: NcoA1, STAT6, PAS-B domain, transactivation domain, transcription
Deposited on 2017-05-08, released 2017-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor coactivator 1
    Species: Mus musculus [TaxId:10090]
    Gene: NCOA1, SRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70365
      • conflict (89)
    Domains in SCOPe 2.08: d5nwxa_
  • Chain 'B':
    Compound: signal transducer and activator of transcription 6
    Species: Homo sapiens [TaxId:9606]
    Gene: STAT6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5nwxA (A:)
ghmtgvesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarql
fqevmtrgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidrehsglsp
qddtnsgmsipr

    Sequence, based on observed residues (ATOM records): (download) 
    >5nwxA (A:)
vesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqevm
trgtasspsyrfilndgtmlsahtrcklcypqpfimgihiidr

  • Chain 'B':
    No sequence available.