PDB entry 5nws

View 5nws on RCSB PDB site
Description: Crystal structure of saAcmM involved in actinomycin biosynthesis
Class: biosynthetic protein
Keywords: actinomycin, P450, biosynthetic protein
Deposited on 2017-05-08, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: saAcmM
    Species: Streptomyces antibioticus [TaxId:1890]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NWS (Start-434)
    Domains in SCOPe 2.07: d5nwsa_
  • Heterogens: GOL, PG4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nwsA (A:)
    ghmshashdtgsttvagaacpaagphmmdpdlladpftgygrlrergpvvrgrfvdgtpv
    wfvtryddvravlrdprfvntpspvpgeggadpregmmdllnvpeplrvyllgsildsdp
    pdhprlrrlvtrafaarrilglrpgieriadrllaelprreeedgtvdllehfayplsit
    vicelvgipatdlerwrewggdlvsmrperlrhsfpvmidychrlieqrraaltddllse
    liraqdddggrlsdietvtmiltlvlaghetsahligngtaallthpgqwallrkdpall
    pravhelmrwcgsvhvarlryatedlelagtpvargdavqlvlvsanfdprhysdpdrld
    itrhqegqaenhvgfghgihyclgatlarqegevalarlletypdlaladgdpevrrarl
    pgswrldalrlrlrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nwsA (A:)
    agphmmdpdlladpftgygrlrergpvvrgrfvdgtpvwfvtryddvravlrdprfvntp
    snvpeplrvyllgsildsdppdhprlrrlvtrafaarrilglrpgieriadrllaelprr
    eeedgtvdllehfayplsitvicelvgipatdlerwrewggdlvsmrperlrhsfpvmid
    ychrlieqrraaltddllseliraqdddggrlsdietvtmiltlvlaghetsahligngt
    aallthpgqwallrkdpallpravhelmrwcgsvhvarlryatedlelagtpvargdavq
    lvlvsanfdprhysdpdrlditrhqegqaenhvgfghgihyclgatlarqegevalarll
    etypdlaladgdpevrrarlpgswrldalrlrlrp