PDB entry 5nwo

View 5nwo on RCSB PDB site
Description: scaffold-ligand complex
Deposited on 2017-05-07, released 2018-05-30
Made obsolete by 6y3e on 2020-03-04

The last revision was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase F, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIF, CYP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30405 (1-164)
      • conflict (132)
  • Heterogens: 9CK, EDO, 12P, PO4, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5nwoA (A:)
mgnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsf
mcqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktd
wldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

    Sequence, based on observed residues (ATOM records):
    >5nwoA (A:)
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls