PDB entry 5nwo

View 5nwo on RCSB PDB site
Description: Human Cyclophilin D Complexed with Inhibitor
Class: isomerase
Keywords: Peptidyl-prolyl cis-trans isomerase F, mitochondrial, isomerase
Deposited on 2017-05-07, released 2018-05-30
Made obsolete by 6y3e on 2020-03-04

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase F, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIF, CYP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30405 (1-164)
      • conflict (132)
    Domains in SCOPe 2.07: d5nwoa_
  • Heterogens: 9CK, EDO, 12P, PO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nwoA (A:)
    mgnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsf
    mcqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktd
    wldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nwoA (A:)
    gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
    cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
    ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls