PDB entry 5nwm

View 5nwm on RCSB PDB site
Description: Insight into the molecular recognition mechanism of the coactivator NCoA1 by STAT6
Class: signaling protein
Keywords: NCoA-1, STAT6, PAS-B domain, transactivation domain, LXXLL motif, signaling protein
Deposited on 2017-05-06, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nuclear receptor coactivator 1
  Species: Homo sapiens [TaxId:9606]
  Gene: NCOA1, BHLHE74, SRC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15788 (3-131)
    • expression tag (0-2)
    • engineered mutation (89)
  Domains in SCOPe 2.07: d5nwma1, d5nwma2
• Chain 'B':
  Compound: signal transducer and activator of transcription 6
  Species: Homo sapiens [TaxId:9606]
  Gene: STAT6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42226 (0-31)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5nwmA (A:)
  ghmtgvesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarql
  fqevmtrgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidrehsglsp
  qddtnsgmsipr
  

  
  
• Chain 'B':
  No sequence available.