PDB entry 5nwm

View 5nwm on RCSB PDB site
Description: Insight into the molecular recognition mechanism of the coactivator NCoA1 by STAT6
Class: signaling protein
Keywords: NCoA-1, STAT6, PAS-B domain, transactivation domain, LXXLL motif, signaling protein
Deposited on 2017-05-06, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA1, BHLHE74, SRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15788 (3-131)
      • expression tag (0-2)
      • engineered mutation (89)
    Domains in SCOPe 2.06: d5nwma1, d5nwma2
  • Chain 'B':
    Compound: signal transducer and activator of transcription 6
    Species: Homo sapiens [TaxId:9606]
    Gene: STAT6
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nwmA (A:)
    ghmtgvesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarql
    fqevmtrgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidrehsglsp
    qddtnsgmsipr
    

  • Chain 'B':
    No sequence available.