PDB entry 5nwe

View 5nwe on RCSB PDB site
Description: Complex of H275Y mutant variant of neuraminidase from H1N1 influenza virus with oseltamivir
Class: hydrolase
Keywords: neuraminidase, influenza, hydrolase
Deposited on 2017-05-05, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nwea_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nweb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nwec_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nwed_
  • Heterogens: CA, G39, NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nweA (A:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nweB (B:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nweC (C:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nweD (D:)
    svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
    dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
    avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg
    kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
    fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
    gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
    sisfcgvnsdtvgwswpdgaelpftidk