PDB entry 5nw7

View 5nw7 on RCSB PDB site
Description: Crystal structure of candida albicans phosphomannose isomerase in complex with inhibitor
Class: isomerase
Keywords: aldose-ketose isomerase, isomerase, complex inhibitor
Deposited on 2017-05-05, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannose-6-phosphate isomerase
    Species: Candida albicans [TaxId:5476]
    Gene: PMI1, MANA, CAALFM_C209640WA, CaO19.1390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nw7a_
  • Heterogens: ZN, 9C2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nw7A (A:)
    mrgshhhhhhgmasmsseklfriqcgyqnydwgkigsssavaqfvhnsdpsitidetkpy
    aelwmgthpsvpskaidlnnqtlrdlvtakpqeylgesiitkfgsskelpflfkvlsiek
    vlsiqahpdkklgaqlhaadpknypddnhkpemaiavtdfegfcgfkpldqlaktlatvp
    elneiigqelvdefisgiklpaevgsqddvnnrkllqkvfgklmntdddvikqqtaklle
    rtdrepqvfkdidsrlpeliqrlnkqfpndiglfcgclllnhvglnkgeamflqakdpha
    yisgdiiecmaasdnvvragftpkfkdvknlvemltysyesvekqkmplqefprskgdav
    ksvlydppiaefsvlqtifdkskggkqvieglngpsiviatngkgtiqitgddstkqkid
    tgyvffvapgssieltadsanqdqdfttyrafvea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw7A (A:)
    sseklfriqcgyqnydwgkigsssavaqfvhnsdpsitidetkpyaelwmgthpsvpska
    idlnnqtlrdlvtakpqeylgesiitkfgsskelpflfkvlsiekvlsiqahpdkklgaq
    lhaadpknypddnhkpemaiavtdfegfcgfkpldqlaktlatvpelneiigqelvdefi
    sgiklpaevgsqddvnnrkllqkvfgklmntdddvikqqtakllertdrepqvfkdidsr
    lpeliqrlnkqfpndiglfcgclllnhvglnkgeamflqakdphayisgdiiecmaasdn
    vvragftpkfkdvknlvemltysyesvekqkmplqefprskgdavksvlydppiaefsvl
    qtifdkskggkqvieglngpsiviatngkgtiqitgddstkqkidtgyvffvapgssiel
    tadsanqdqdfttyrafvea