PDB entry 5nw2

View 5nw2 on RCSB PDB site
Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-3,3-dimethyl-2-(oxetane-3-carboxamido)butanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 19)
Class: ligase
Keywords: protein complex, ubiquitin ligase, hypoxia inducible factor, Ligase
Deposited on 2017-05-04, released 2017-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nw2a_
  • Chain 'B':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5nw2b1, d5nw2b2
  • Chain 'C':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nw2c_
  • Chain 'D':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nw2d_
  • Chain 'E':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5nw2e1, d5nw2e2
  • Chain 'F':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nw2f_
  • Chain 'G':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nw2g_
  • Chain 'H':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5nw2h1, d5nw2h2
  • Chain 'I':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nw2i_
  • Chain 'J':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nw2j_
  • Chain 'K':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5nw2k1, d5nw2k2
  • Chain 'L':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nw2l_
  • Heterogens: 9B8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nw2A (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nw2B (B:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2B (B:)
    mmyvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytn
    ssteipefpiapeialellmaanfldc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nw2C (C:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2C (C:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nw2D (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2D (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5nw2E (E:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2E (E:)
    mmyvklissdghefivkrehaltsgtikamlsgnetnevnfreipshvlskvcmyftykv
    rytnssteipefpiapeialellmaanfldc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nw2F (F:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2F (F:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5nw2G (G:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2G (G:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5nw2H (H:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2H (H:)
    mmyvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvry
    tnssteipefpiapeialellmaanfldc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5nw2I (I:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2I (I:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqe
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nw2J (J:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5nw2K (K:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2K (K:)
    mmyvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5nw2L (L:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nw2L (L:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqe