PDB entry 5nv2

View 5nv2 on RCSB PDB site
Description: Human DNMT3B PWWP domain in complex with N-isopropyl-1,5-dimethylhexylamine (Metron S)
Class: transferase
Keywords: dnmt3b pwwp domain, histone binding, beta barrel, ligand, transferase
Deposited on 2017-05-03, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (cytosine-5)-methyltransferase 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dnmt3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nv2a_
  • Chain 'B':
    Compound: DNA (cytosine-5)-methyltransferase 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dnmt3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nv2b_
  • Heterogens: 9AE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nv2A (A:)
    eadsgdgdsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfg
    dgkfsevsadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsl
    edqlkpmlewahggfkptgieglkpnntqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nv2A (A:)
    seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
    dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpssledqlkpmlewahg
    gfkptgieglkpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nv2B (B:)
    eadsgdgdsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfg
    dgkfsevsadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsl
    edqlkpmlewahggfkptgieglkpnntqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nv2B (B:)
    seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
    dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpssledqlkpmlewahg
    gfkptgieglkpn