PDB entry 5nv1

View 5nv1 on RCSB PDB site
Description: SH3 domain from Mouse cortactin (C 2 2 21 crystal form)
Class: signaling protein
Keywords: SH3 domain, cortactin, signaling, cancer, invadopodium, signaling protein
Deposited on 2017-05-03, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Src substrate cortactin
    Species: Mus musculus [TaxId:10090]
    Gene: Cttn, Ems1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60598 (3-59)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5nv1a1, d5nv1a2
  • Heterogens: MES, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nv1A (A:)
    ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq