PDB entry 5nv1

View 5nv1 on RCSB PDB site
Description: SH3 domain from Mouse cortactin (C 2 2 21 crystal form)
Class: signaling protein
Keywords: SH3 domain, cortactin, signaling, cancer, invadopodium, signaling protein
Deposited on 2017-05-03, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Src substrate cortactin
  Species: Mus musculus [TaxId:10090]
  Gene: Cttn, Ems1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60598 (3-59)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d5nv1a1, d5nv1a2
• Heterogens: MES, GOL, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5nv1A (A:)
  ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq