PDB entry 5nv0

View 5nv0 on RCSB PDB site
Description: Human DNMT3B PWWP domain in complex with 4-(dipropylamino)butyronitrile
Class: transferase
Keywords: dnmt3b pwwp domain, histone binding, beta barrel, ligand, transferase
Deposited on 2017-05-03, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (cytosine-5)-methyltransferase 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dnmt3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nv0a_
  • Chain 'B':
    Compound: DNA (cytosine-5)-methyltransferase 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: Dnmt3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nv0b_
  • Heterogens: 9AH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nv0A (A:)
    eadsgdgdsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfg
    dgkfsevsadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsl
    edqlkpmlewahggfkptgieglkpnntqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nv0A (A:)
    seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
    dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpssledqlkpmlewahg
    gfkptgieglkpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nv0B (B:)
    eadsgdgdsseyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfg
    dgkfsevsadklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsl
    edqlkpmlewahggfkptgieglkpnntqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nv0B (B:)
    seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
    dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpssledqlkpmlewahg
    gfkptgieglkpn