PDB entry 5nux

View 5nux on RCSB PDB site
Description: Thermus scotoductus SA-01 Ene-reductase double mutant TsER_C25D_I67T
Class: oxidoreductase
Keywords: Ene-reductase Old yellow enzyme C25D_I67T, oxidoreductase
Deposited on 2017-05-03, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromate reductase
    Species: Thermus scotoductus [TaxId:37636]
    Gene: chrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0JDW3 (Start-348)
      • engineered mutation (24)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5nuxa_
  • Chain 'B':
    Compound: Chromate reductase
    Species: Thermus scotoductus [TaxId:37636]
    Gene: chrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0JDW3 (Start-348)
      • engineered mutation (24)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5nuxb_
  • Chain 'C':
    Compound: Chromate reductase
    Species: Thermus scotoductus [TaxId:37636]
    Gene: chrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0JDW3 (Start-348)
      • engineered mutation (24)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5nuxc_
  • Chain 'D':
    Compound: Chromate reductase
    Species: Thermus scotoductus [TaxId:37636]
    Gene: chrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0JDW3 (Start-348)
      • engineered mutation (24)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5nuxd_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nuxA (A:)
    mallftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveata
    veplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkpl
    gwrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgylls
    sflsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsled
    tlafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittp
    eqaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nuxA (A:)
    allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
    eplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkplg
    wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
    flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
    lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
    qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nuxB (B:)
    mallftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveata
    veplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkpl
    gwrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgylls
    sflsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsled
    tlafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittp
    eqaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nuxB (B:)
    allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
    eplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkplg
    wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
    flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
    lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
    qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nuxC (C:)
    mallftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveata
    veplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkpl
    gwrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgylls
    sflsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsled
    tlafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittp
    eqaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nuxC (C:)
    allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
    eplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkplg
    wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
    flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
    lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
    qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nuxD (D:)
    mallftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveata
    veplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkpl
    gwrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgylls
    sflsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsled
    tlafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittp
    eqaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nuxD (D:)
    allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
    eplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkplg
    wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
    flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
    lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
    qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf