PDB entry 5nul

View 5nul on RCSB PDB site
Description: clostridium beijerinckii flavodoxin mutant: g57t semiquinone (150k)
Deposited on 1996-12-20, released 1997-03-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.183
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d5nul__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nul_ (-)
    mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamtdev
    leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
    pdeaeqdciefgkkiani