PDB entry 5nuj

View 5nuj on RCSB PDB site
Description: Engineered beta-lactoglobulin: variant I56F-L39A in complex with chlorpromazine (LG-FA-CLP)
Class: transport protein
Keywords: lactoglobulin, chlorpromazine, mutation, complex, transport protein
Deposited on 2017-04-30, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: LGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754 (Start-161)
      • engineered mutation (38)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5nuja_
  • Heterogens: Z80, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nujA (A:)
    asvtqtmkgldiqkvagtwyslamaasdislldaqsaparvyveelkptpegdlefllqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nujA (A:)
    vtqtmkgldiqkvagtwyslamaasdislldaqsaparvyveelkptpegdlefllqkwe
    ngecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensqslacqclvrtp
    evddealekfdkalkalpmhirlsfnptqleeqchi