PDB entry 5nud

View 5nud on RCSB PDB site
Description: fibroblast growth factor receptor 4 kinase domain (449-753) in complex with irreversible ligand cga159527
Class: hormone/growth factor
Keywords: OTHER, HORMONE-GROWTH FACTOR complex
Deposited on 2017-04-29, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nuda_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22455 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5nudb1, d5nudb2
  • Heterogens: 99K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nudA (A:)
    gplvsldlpldplwefprdrlvlgkplgegcfgqvvraeafgmdparpdqastvavkmlk
    dnasdkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflrarr
    ppgpdlspdgprssegplsfpvlvscayqvargmqylesrkcihrdlaarnvlvtednvm
    kiadfglargvhhidyykktsngrlpvkwmapealfdrvythqsdvwsfgillweiftlg
    gspypgipveelfsllreghrmdrpphcppelyglmrecwhaapsqrptfkqlvealdkv
    llavsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nudA (A:)
    dlpldplwefprdrlvlgkplgeggqvvraeafgmdparpdqastvavkmlkdnasdkdl
    adlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflrarrpplsfpvl
    vscayqvargmqylesrkcihrdlaarnvlvtednvmkiadfgrlpvkwmapealfdrvy
    thqsdvwsfgillweiftlggspypgipveelfsllreghrmdrpphcppelyglmrecw
    haapsqrptfkqlvealdkvllavsee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nudB (B:)
    gplvsldlpldplwefprdrlvlgkplgegcfgqvvraeafgmdparpdqastvavkmlk
    dnasdkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflrarr
    ppgpdlspdgprssegplsfpvlvscayqvargmqylesrkcihrdlaarnvlvtednvm
    kiadfglargvhhidyykktsngrlpvkwmapealfdrvythqsdvwsfgillweiftlg
    gspypgipveelfsllreghrmdrpphcppelyglmrecwhaapsqrptfkqlvealdkv
    llavsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nudB (B:)
    plvsldlpldplwefprdrlvlgkplgegcfgqvvraeafgmdparpdqastvavkmlkd
    nasdkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflrarrp
    pplsfpvlvscayqvargmqylesrkcihrdlaarnvlvtednvmkiadfrlpvkwmape
    alfdrvythqsdvwsfgillweiftlggspypgipveelfsllreghrmdrpphcppely
    glmrecwhaapsqrptfkqlvealdkvllav