PDB entry 5nu8

View 5nu8 on RCSB PDB site
Description: Structure of human urine RBP4 saturated with palmitate
Class: transport protein
Keywords: RBP4, plasma retinol-binding protein, lipocalin, palmitate, transport protein
Deposited on 2017-04-28, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinol-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nu8a_
  • Heterogens: PLM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nu8A (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
    rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdgrser
    nl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nu8A (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
    rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycd