PDB entry 5nu5
View 5nu5 on RCSB PDB site
Description: Crystal structure of the human bromodomain of EP300 bound to the inhibitor XDM-CBP
Class: transferase
Keywords: bromodomain, protein-inhibitor complex, epigenetics, EP300, transferase
Deposited on
2017-04-28, released
2017-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-11, with a file datestamp of
2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Histone acetyltransferase p300
Species: Homo sapiens [TaxId:9606]
Gene: EP300, P300
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5nu5a1, d5nu5a2 - Chain 'B':
Compound: Histone acetyltransferase p300
Species: Homo sapiens [TaxId:9606]
Gene: EP300, P300
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5nu5b1, d5nu5b2 - Heterogens: 99E, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5nu5A (A:)
smifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrk
ldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5nu5B (B:)
smifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrk
ldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg