PDB entry 5nu5

View 5nu5 on RCSB PDB site
Description: Crystal structure of the human bromodomain of EP300 bound to the inhibitor XDM-CBP
Class: transferase
Keywords: bromodomain, protein-inhibitor complex, epigenetics, EP300, transferase
Deposited on 2017-04-28, released 2017-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (2-115)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d5nu5a1, d5nu5a2
  • Chain 'B':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (2-115)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d5nu5b1, d5nu5b2
  • Heterogens: 99E, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nu5A (A:)
    smifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrk
    ldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nu5B (B:)
    smifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrk
    ldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg