PDB entry 5ns8

View 5ns8 on RCSB PDB site
Description: Crystal structure of beta-glucosidase BglM-G1 mutant H75R from marine metagenome in complex with inhibitor 1-Deoxynojirimycin
Class: hydrolase
Keywords: hydrolase, beta-glucosidase, metagenomes
Deposited on 2017-04-25, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase M - G1
    Species: marine metagenome [TaxId:408172]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NS8 (Start-453)
    Domains in SCOPe 2.08: d5ns8a1, d5ns8a2
  • Chain 'B':
    Compound: beta-glucosidase M - G1
    Species: marine metagenome [TaxId:408172]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NS8 (Start-453)
    Domains in SCOPe 2.08: d5ns8b1, d5ns8b2
  • Chain 'C':
    Compound: beta-glucosidase M - G1
    Species: marine metagenome [TaxId:408172]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NS8 (Start-453)
    Domains in SCOPe 2.08: d5ns8c1, d5ns8c2
  • Heterogens: SO4, GOL, NOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ns8A (A:)
    mhhhhhhenlyfqghmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavan
    gdngdvacdhyhrynedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidg
    alergitpwptlyhwdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinep
    fcsawlghlygvmapgikdlktginashhlllghglatkairevsselkvgitlnftpai
    tlgessedklaveladgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldy
    lglnyyfrqtveydatakplpykqvtapnvertgmgwevhaqsftellervskeykpkei
    fitengsawddevvdgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfeway
    gyakrfgiiyvdyqtqkripkssayyyqkrikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ns8A (A:)
    hmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavangdngdvacdhyhry
    nedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidgalergitpwptlyh
    wdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinepfcsawlghlygvma
    pgikdlktginashhlllghglatkairevsselkvgitlnftpaitlgessedklavel
    adgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldylglnyyfrqtveyd
    atakplpykqvtapnvertgmgwevhaqsftellervskeykpkeifitengsawddevv
    dgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfewaygyakrfgiiyvdyq
    tqkripkssayyyqkrikes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ns8B (B:)
    mhhhhhhenlyfqghmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavan
    gdngdvacdhyhrynedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidg
    alergitpwptlyhwdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinep
    fcsawlghlygvmapgikdlktginashhlllghglatkairevsselkvgitlnftpai
    tlgessedklaveladgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldy
    lglnyyfrqtveydatakplpykqvtapnvertgmgwevhaqsftellervskeykpkei
    fitengsawddevvdgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfeway
    gyakrfgiiyvdyqtqkripkssayyyqkrikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ns8B (B:)
    hmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavangdngdvacdhyhry
    nedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidgalergitpwptlyh
    wdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinepfcsawlghlygvma
    pgikdlktginashhlllghglatkairevsselkvgitlnftpaitlgessedklavel
    adgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldylglnyyfrqtveyd
    atakplpykqvtapnvertgmgwevhaqsftellervskeykpkeifitengsawddevv
    dgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfewaygyakrfgiiyvdyq
    tqkripkssayyyqkrikes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ns8C (C:)
    mhhhhhhenlyfqghmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavan
    gdngdvacdhyhrynedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidg
    alergitpwptlyhwdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinep
    fcsawlghlygvmapgikdlktginashhlllghglatkairevsselkvgitlnftpai
    tlgessedklaveladgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldy
    lglnyyfrqtveydatakplpykqvtapnvertgmgwevhaqsftellervskeykpkei
    fitengsawddevvdgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfeway
    gyakrfgiiyvdyqtqkripkssayyyqkrikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ns8C (C:)
    hmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavangdngdvacdhyhry
    nedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidgalergitpwptlyh
    wdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinepfcsawlghlygvma
    pgikdlktginashhlllghglatkairevsselkvgitlnftpaitlgessedklavel
    adgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldylglnyyfrqtveyd
    atakplpykqvtapnvertgmgwevhaqsftellervskeykpkeifitengsawddevv
    dgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfewaygyakrfgiiyvdyq
    tqkripkssayyyqkrikes