PDB entry 5ns7

View 5ns7 on RCSB PDB site
Description: Crystal structure of beta-glucosidase BglM-G1 mutant H75R from marine metagenome
Class: hydrolase
Keywords: hydrolase, beta-glucosidase, metagenomes
Deposited on 2017-04-25, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase M - G1
    Species: marine metagenome [TaxId:408172]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NS7 (Start-453)
    Domains in SCOPe 2.07: d5ns7a1, d5ns7a2
  • Chain 'B':
    Compound: beta-glucosidase M - G1
    Species: marine metagenome [TaxId:408172]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NS7 (Start-453)
    Domains in SCOPe 2.07: d5ns7b1, d5ns7b2
  • Chain 'C':
    Compound: beta-glucosidase M - G1
    Species: marine metagenome [TaxId:408172]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NS7 (Start-453)
    Domains in SCOPe 2.07: d5ns7c1, d5ns7c2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ns7A (A:)
    mhhhhhhenlyfqghmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavan
    gdngdvacdhyhrynedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidg
    alergitpwptlyhwdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinep
    fcsawlghlygvmapgikdlktginashhlllghglatkairevsselkvgitlnftpai
    tlgessedklaveladgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldy
    lglnyyfrqtveydatakplpykqvtapnvertgmgwevhaqsftellervskeykpkei
    fitengsawddevvdgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfeway
    gyakrfgiiyvdyqtqkripkssayyyqkrikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ns7A (A:)
    hmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavangdngdvacdhyhry
    nedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidgalergitpwptlyh
    wdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinepfcsawlghlygvma
    pgikdlktginashhlllghglatkairevsselkvgitlnftpaitlgessedklavel
    adgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldylglyyfrqtveyda
    takplpykqvtapnvertgmgwevhaqsftellervskeykpkeifitengsawddevvd
    gkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfewaygyakrfgiiyvdyqt
    qkripkssayyyqkrikes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ns7B (B:)
    mhhhhhhenlyfqghmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavan
    gdngdvacdhyhrynedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidg
    alergitpwptlyhwdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinep
    fcsawlghlygvmapgikdlktginashhlllghglatkairevsselkvgitlnftpai
    tlgessedklaveladgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldy
    lglnyyfrqtveydatakplpykqvtapnvertgmgwevhaqsftellervskeykpkei
    fitengsawddevvdgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfeway
    gyakrfgiiyvdyqtqkripkssayyyqkrikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ns7B (B:)
    hmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavangdngdvacdhyhry
    nedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidgalergitpwptlyh
    wdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinepfcsawlghlygvma
    pgikdlktginashhlllghglatkairevsselkvgitlnftpaitlgessedklavel
    adgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldylglnyyfrqtveyd
    atakplpykqvtapnvertgmgwevhaqsftellervskeykpkeifitengsawddevv
    dgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfewaygyakrfgiiyvdyq
    tqkripkssayyyqkrikes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ns7C (C:)
    mhhhhhhenlyfqghmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavan
    gdngdvacdhyhrynedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidg
    alergitpwptlyhwdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinep
    fcsawlghlygvmapgikdlktginashhlllghglatkairevsselkvgitlnftpai
    tlgessedklaveladgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldy
    lglnyyfrqtveydatakplpykqvtapnvertgmgwevhaqsftellervskeykpkei
    fitengsawddevvdgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfeway
    gyakrfgiiyvdyqtqkripkssayyyqkrikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ns7C (C:)
    hmkkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavangdngdvacdhyhry
    nedldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidgalergitpwptlyh
    wdlpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinepfcsawlghlygvma
    pgikdlktginashhlllghglatkairevsselkvgitlnftpaitlgessedklavel
    adgfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldylglnyyfrqtveyd
    atakplpykqvtapnvertgmgwevhaqsftellervskeykpkeifitengsawddevv
    dgkvddpnrvsylerhldamfaaknkgvpisgyfawslidnfewaygyakrfgiiyvdyq
    tqkripkssayyyqkrikes